Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human Gastrotropin/FABP6 Protein

Cat. No.: IBDP-532761

Size:

Target Information

Synonyms rHuGastrotropin/FABP6, His|||Gastrotropin|||GT|||Fatty Acid-Binding Protein 6|||Ileal Lipid-Binding Protein|||ILBP|||Intestinal 15 kDa Protein|||I-15P|||Intestinal Bile Acid-Binding Protein|||I-BABP|||FABP6|||ILBP|||ILLBP
Sequence MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA

Product Details

Product Type Protein
Species Human
Source E. coli
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 15.0 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.