Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human GABARAPL1/GEC-1 Protein

Cat. No.: IBDP-531440

Size:

Target Information

Synonyms Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 1|||Early Estrogen-Regulated Protein|||GABA(A) Receptor-Associated Protein-Like 1|||Glandular Epithelial Cell Protein 1|||GEC-1|||GABARAPL1|||GEC1
Sequence MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

Product Details

Product Type Protein
Species Human
Source E. coli
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 20.0 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.