Cat. No.: IBDP-530879
Size:
Online InquiryTarget Information
| Synonyms | rHuFlt-3 Ligand|||Flt3 ligand|||FL|||SL cytokine|||Flt-3L |
| Sequence | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPP |
| Function | FLT3LG Protein (CHO) is a cytokine, which can promote the generation and differentiation of hematopoietic stem cells and their progenitor cells. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | CHO Cells |
| Tag | Tag Free |
| Endotoxin Level | <0.2 Eu/μg |
| Molecular Weight | 18-22 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |