Recombinant Human FGF2 Protein

Target Information

Sequence	PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH IKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLES NNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Sequence Similarities	Belongs to the heparin-binding growth factors family.
Amino Acids	143 to 288
Cellular Localization	Secreted. Nucleus. Exported from cells by an endoplasmic reticulum (ER)/Golgi-independent mechanism. Unconventional secretion of FGF2 occurs by direct translocation across the plasma membrane. Binding of exogenous FGF2 to FGFR facilitates endocytosis followed by translocation of FGF2 across endosomal membrane into the cytosol. Nuclear import from the cytosol requires the classical nuclear import machinery, involving proteins KPNA1 and KPNB1, as well as CEP57.
Tissue Specificity	Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue.
Function	Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis (PubMed:23469107).

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Endotoxin Level	<0.1 Eu/μg
Protein Length	Full length protein
Molecular Weight	16 kDa
Purity	≥98%
Active	Yes
Animal free	No
Nature	Recombinant
Application	FuncS, HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.