Cat. No.: IBDP-530165
Size:
Online InquiryTarget Information
| Sequence | LAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQ SAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEE EIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPE EPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
| Sequence Similarities | Belongs to the heparin-binding growth factors family. |
| Amino Acids | 25 to 216 |
| Cellular Localization | Secreted. |
| Tissue Specificity | Expressed in fetal brain, cartilage, retina, and adult gall bladder. |
| Function | Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Endotoxin Level | ≤0.005 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 21 kDa |
| Purity | ≥95% |
| Active | Yes |
| Animal free | Yes |
| Nature | Recombinant |
| Application | Cell Culture, FuncS, HPLC, MS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at Room Temperature. |
| Handling | Avoid freeze / thaw cycle. |