Cat. No.: IBDP-530972
Size:
Online InquiryTarget Information
| Sequence | MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVG LRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSST LYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQS LHEIGEKQGRSRKSSGTPTMNGGKVVNQDST |
| Sequence Similarities | Belongs to the heparin-binding growth factors family. |
| Amino Acids | 1 to 181 |
| Cellular Localization | Nucleus. |
| Tissue Specificity | Brain, eye and testis; highly expressed in embryonic retina, olfactory epithelium, olfactory bulb, and in a segmental pattern of the body wall; in adult olfactory bulb, less in cerebellum, deep cerebellar nuclei, cortex and multiple midbrain structures. |
| Function | Probably involved in nervous system development and function. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Endotoxin Level | <1.0 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 21 kDa |
| Purity | >95% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -80 °C. |
| Handling | Avoid freeze / thaw cycle. |