Recombinant Human FGF 23 Protein

Target Information

Sequence	YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALM IRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGY DVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIP RRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPL GVVRGGRVNTHAGGTGPEGCRPFAKFI
Sequence Similarities	Belongs to the heparin-binding growth factors family.
Amino Acids	25 to 251
Cellular Localization	Secreted. Secretion is dependent on O-glycosylation.
Tissue Specificity	Expressed in osteogenic cells particularly during phases of active bone remodeling. In adult trabecular bone, expressed in osteocytes and flattened bone-lining cells (inactive osteoblasts).
Function	Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Upregulates EGR1 expression in the presence of KL (By similarity). Acts directly on the parathyroid to decrease PTH secretion (By similarity). Regulator of vitamin-D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization.

Product Details

Product Type	Protein
Species	Human
Source	HEK 293 Cells
Endotoxin Level	≤0.005 Eu/µg
Protein Length	Full length protein
Molecular Weight	25 kDa
Purity	≥95%
Active	Yes
Animal free	Yes
Nature	Recombinant
Application	FuncS, HPLC, MS, SDS-PAGE

Storage & Handling

Shipping	Shipped at Room Temperature.
Storage	Store at Room Temperature.
Handling	Avoid freeze / thaw cycle.