Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human FABP2/I-FABP Protein

Cat. No.: IBDP-530475

Size:

Target Information

Synonyms rHuFatty acid-binding protein/FABP2, His|||Fatty Acid-Binding Protein Intestinal|||Fatty Acid-Binding Protein 2|||Intestinal-Type Fatty Acid-Binding Protein|||I-FABP|||FABP2|||FABPI
Sequence MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Product Details

Product Type Protein
Species Human
Source E. coli
Tag 6*His, 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 18 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.