Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human EpCAM/TROP1 Protein

Cat. No.: IBDP-532748

Size:

Target Information

Synonyms rHuEpithelial cell adhesion molecule/EpCAM, Fc |||Epithelial Cell Adhesion Molecule|||Ep-CAM|||Adenocarcinoma-Associated Antigen|||Cell Surface Glycoprotein Trop-1|||Epithelial Cell Surface Antigen|||Epithelial Glycoprotein 314|||EGP314|||Major Gastrointestinal Tumor-Associated Protein GA733-2|||Tumor-Associated
Sequence QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag hFc
Endotoxin Level <1.0 Eu/µg
Molecular Weight 60-80 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.