Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human EpCAM/TROP1 Protein

Cat. No.: IBDP-530577

Size:

Target Information

Synonyms 17 1A|||323/A3|||Adenocarcinoma associated antigen|||Adenocarcinoma-associated antigen|||Antigen identified by monoclonal AUA1|||AUA1|||CD326|||CD326 antigen|||Cell surface glycoprotein Trop 1|||Cell surface glycoprotein Trop 2|||Cell surface glycoprotein Trop-1|||CO 17A|||CO17 1A|||CO17A|||DIAR5|||EGP 2|||EGP|||EGP2|||EGP314|||EGP40|||Ep CAM|||Ep-CAM|||EPCAM|||EPCAM_HUMAN|||EpCAM1|||Epithelial cell adhesion molecule|||Epithelial Cell Adhesion Molecule Intracellular Domain EpCAM-ICD||||||Epithelial cell surface antigen|||Epithelial cellular adhesion molecule|||Epithelial glycoprotein 1|||Epithelial glycoprotein 314|||Epithelial glycoprotein|||ESA|||GA733 1|||GA733 2|||GA733-2|||gastrointestinal tumor-associated antigen 2|||35-KD glycoprotein|||gp4|||hEGP 2|||hEGP314|||HNPCC8|||Human epithelial glycoprotein 2|||KS 1/4 antigen|||KS1/4|||KSA|||Ly74|||Lymphocyte antigen 74|||M1S 1|||M1S2|||M4S1|||Major gastrointestinal tumor associated protein GA733 2|||Major gastrointestinal tumor-associated protein GA733-2|||mEGP314|||Membrane component chro
Sequence QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Product Details

Product Type Protein
Species Human
Source E. coli
Tag 6*His, SUMO
Endotoxin Level <1.0 Eu/µg
Molecular Weight 40.4 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.