Cat. No.: IBDP-530075
Size:
Online InquiryTarget Information
| Sequence | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGD PKQEWVQRYMKNLDAKQKKASPRARAVA |
| Sequence Similarities | Belongs to the intercrine beta (chemokine CC) family. |
| Amino Acids | 27 to 104 |
| Cellular Localization | Secreted. |
| Tissue Specificity | Activated monocytes and activated T lymphocytes. |
| Function | Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Endotoxin Level | <1.0 Eu/µg |
| Protein Length | Protein fragment |
| Molecular Weight | 9 kDa |
| Purity | >97% |
| Active | Yes |
| Animal free | No |
| Nature | Recombinant |
| Application | FuncS, HPLC, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |