Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human Eotaxin 2 Protein

Cat. No.: IBDP-530076

Size:

Target Information

Sequence VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGD PKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Sequence Similarities Belongs to the intercrine beta (chemokine CC) family.
Amino Acids 27 to 119
Cellular Localization Secreted.
Tissue Specificity Activated monocytes and activated T lymphocytes.
Function Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3.

Product Details

Product Type Protein
Species Human
Source CHO Cells
Endotoxin Level <0.06 Eu/µg
Protein Length Full length protein
Molecular Weight 10 kDa
Purity ≥98%
Active No
Animal free No
Nature Recombinant
Application SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.