Recombinant Human EMAP II/AIMP1 Protein

Target Information

Sequence	ANNDAVLKRLEQKGAEADQIIEYLKQQVSLLKEKAILQATLREEKKLRVE NAKLKKEIEELKQELIQAEIQNGVKQIPFPSGTPLHANSMVSENVIQSTA VTTVSSGTKEQIKGGTGDEKKAKEKIEKKGEKKEKKQQSIAGSADSKPID VSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQ MQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRI TFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVC RAQTMSNSGIK
Sequence Similarities	Contains 1 tRNA-binding domain.
Amino Acids	2 to 312
Cellular Localization	Nucleus. Cytoplasm > cytosol. Cytoplasmic vesicle > secretory vesicle. Secreted. Endoplasmic reticulum. Golgi apparatus. Enriched in secretory vesicles of pancreatic alpha cells and secreted from the pancreas in response to low glucose levels (By similarity). Also secreted in response to hypoxia and both apoptotic and necrotic cell death.
Function	Non-catalytic component of the multisynthase complex. Stimulates the catalytic activity of cytoplasmic arginyl-tRNA synthase. Binds tRNA. Possesses inflammatory cytokine activity. Negatively regulates TGF-beta signaling through stabilization of SMURF2 by binding to SMURF2 and inhibiting its SMAD7-mediated degradation. Involved in glucose homeostasis through induction of glucagon secretion at low glucose levels. Promotes dermal fibroblast proliferation and wound repair. Regulates KDELR1-mediated retention of HSP90B1/gp96 in the endoplasmic reticulum. Plays a role in angiogenesis by inducing endothelial cell migration at low concentrations and endothelian cell apoptosis at high concentrations. Induces maturation of dendritic cells and monocyte cell adhesion. Modulates endothelial cell responses by degrading HIF-1A through interaction with PSMA7.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Tag	His
Endotoxin Level	<1.0 Eu/µg
Protein Length	Full length protein
Molecular Weight	35 kDa
Purity	>95%
Active	No
Animal free	No
Nature	Recombinant
Application	SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.