Recombinant Human Elafin/ESI Protein

Target Information

Sequence	AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTK PGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Sequence Similarities	Contains 1 WAP domain.
Amino Acids	23 to 117
Cellular Localization	Secreted.
Function	Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.

Product Details

Product Type	Protein
Species	Human
Source	HEK 293 Cells
Tag	His
Endotoxin Level	<1.0 Eu/µg
Protein Length	Full length protein
Molecular Weight	10 kDa
Purity	>95%
Active	No
Animal free	No
Nature	Recombinant
Application	SDS-PAGE

Storage & Handling

Shipping	Shipped with Dry Ice.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.