Cat. No.: IBDP-530619
Size:
Online InquiryTarget Information
Sequence | AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTK PGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ |
Sequence Similarities | Contains 1 WAP domain. |
Amino Acids | 23 to 117 |
Cellular Localization | Secreted. |
Function | Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis. |
Product Details
Product Type | Protein |
Species | Human |
Source | HEK 293 Cells |
Tag | His |
Endotoxin Level | <1.0 Eu/µg |
Protein Length | Full length protein |
Molecular Weight | 10 kDa |
Purity | >95% |
Active | No |
Animal free | No |
Nature | Recombinant |
Application | SDS-PAGE |
Storage & Handling
Shipping | Shipped with Dry Ice. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |