Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human EIF3M Protein

Cat. No.: IBDP-531241

Size:

Target Information

Synonyms B5|||B5 receptor|||Dendritic cell protein|||eIF3m|||EIF3M_HUMAN|||Eukaryotic translation initiation factor 3 subunit M|||Fetal lung protein B5|||FLJ29030|||GA17|||hfl B5|||hFL-B5|||PCI domain containing 1 (herpesvirus entry mediator)|||PCI domain-containing protein 1|||PCID1|||TANGO7
Sequence SVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT

Product Details

Product Type Protein
Species Human
Source E. coli
Tag His, SUMO
Endotoxin Level <1.0 Eu/µg
Molecular Weight 58.4 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.