Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human DNAM-1 Protein

Cat. No.: IBDP-531119

Size:

Target Information

Synonyms CD226|||CD226 molecule|||CD226 antigen|||DNAM 1|||DNAM1|||PTA1|||TLiSA1|||adhesion glycoprotein|||DNAX accessory molecule 1|||DNAX accessory molecule-1|||platelet and T cell activation antigen 1|||T lineage-specific activation antigen 1 antigen|||DNAM-1
Sequence EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag Myc, hFc
Endotoxin Level <1.0 Eu/µg
Molecular Weight 56.1 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.