Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human DCN1-like protein 1/DCUN1D1 Protein

Cat. No.: IBDP-531371

Size:

Target Information

Synonyms rHuDCN1-like protein 1/DCUN1D1, His|||DCN1-Like Protein 1|||DCUN1 Domain-Containing Protein 1|||Defective in Cullin Neddylation Protein 1-Like Protein 1|||Squamous Cell Carcinoma-Related Oncogene|||DCUN1D1|||DCUN1L1|||RP42|||SCCRO
Sequence MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV

Product Details

Product Type Protein
Species Human
Source E. coli
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 32.0 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.