Recombinant Human DARC Protein

Target Information

Sequence	MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAP CHSCNLLDDSALPFFILTSVLGILASSTVLSMLFRPLFRWQLCPGWPVLA QLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCH ASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYS TELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWF IFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVAT PLLLALFCHQATRTLLPSLPLPEGWFSHLDTLGSKS
Sequence Similarities	Belongs to the G-protein coupled receptor Duffy family.
Amino Acids	1 to 336
Cellular Localization	Membrane.
Tissue Specificity	Found in adult kidney, adult spleen, bone marrow and fetal liver. In particular, it is expressed along postcapillary venules throughout the body, except in the adult liver. Erythroid cells and postcapillary venule endothelium are the principle tissues expressing duffy. Fy(-A-B) individuals do not express duffy in the bone marrow, however they do, in postcapillary venule endothelium.
Function	Non-specific receptor for many chemokines such as IL-8, GRO, RANTES, MCP-1 and TARC. It is also the receptor for the human malaria parasites Plasmodium vivax and Plasmodium knowlesi.

Product Details

Product Type	Protein
Species	Human
Source	Wheat Germ
Protein Length	Full length protein
Molecular Weight	63 kDa
Active	No
Animal free	No
Nature	Recombinant
Application	ELISA, SDS-PAGE, WB

Storage & Handling

Shipping	Shipped with Dry Ice.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.