Cat. No.: IBDP-531629
Size:
Online InquiryTarget Information
Sequence | MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS |
Sequence Similarities | Belongs to the G-protein coupled receptor 1 family. |
Amino Acids | 1 to 46 |
Cellular Localization | Cell membrane. In unstimulated cells, diffuse pattern on plasma membrane. On agonist stimulation, colocalizes with ITCH at the plasma membrane where it becomes ubiquitinated. |
Tissue Specificity | Expressed in numerous tissues, such as peripheral blood leukocytes, spleen, thymus, spinal cord, heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, cerebellum, cerebral cortex and medulla (in microglia as well as in astrocytes), brain microvascular, coronary artery and umbilical cord endothelial cells. Isoform 1 is predominant in all tissues tested. |
Function | Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ions levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhance intracellular calcium ions and reduce cellular cAMP levels. Involved in haematopoiesis and in cardiac ventricular septum formation. Plays also an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Could be involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival. Acts as a coreceptor (CD4 being the primary receptor) for HIV-1 X4 isolates and as a primary receptor for some HIV-2 isolates. Promotes Env-mediated fusion of the virus. |
Product Details
Product Type | Protein |
Species | Human |
Source | Wheat Germ |
Tag | GST |
Protein Length | Protein fragment |
Animal free | No |
Nature | Recombinant |
Application | ELISA, WB |
Storage & Handling
Shipping | Shipped with Dry Ice. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |