Cat. No.: IBDP-530876
Size:
Online InquiryTarget Information
| Sequence | SGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTL TCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQL |
| Sequence Similarities | Belongs to the G-protein coupled receptor 1 family. |
| Amino Acids | 121 to 220 |
| Cellular Localization | Cell membrane. |
| Tissue Specificity | Isoform 1 and isoform 2 are mainly expressed in heart, kidney, liver and skeletal muscle. Isoform 1 is also expressed in placenta. |
| Function | Receptor for CXCL9, CXCL10 and CXCL11 and mediates the proliferation of human mesangial cells (HMC).Isoform 2 is a receptor for CXCL4 and also mediates the inhibitory activities of CXCL9, CXCL10 and CXCL11 on the growth of human microvascular endothelial cells (HMVEC). May play a role in angiogenesis.Isoform 3 mediates the activity of CXCL11. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | Wheat Germ |
| Tag | GST |
| Protein Length | Protein fragment |
| Molecular Weight | 37 kDa |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | ELISA, SDS-PAGE, WB |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |