Cat. No.: IBDP-531058
Size:
Online InquiryTarget Information
Sequence | TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQ TCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQK KTTVDHHHHHH |
Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
Amino Acids | 23 to 125 |
Cellular Localization | Secreted. |
Function | Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3. |
Product Details
Product Type | Protein |
Species | Human |
Source | HEK 293 Cells |
Tag | His |
Endotoxin Level | <1.0 Eu/µg |
Protein Length | Full length protein |
Molecular Weight | 13 kDa |
Purity | >95% |
Active | No |
Animal free | No |
Nature | Recombinant |
Application | HPLC, SDS-PAGE |
Storage & Handling
Shipping | Shipped at 4 °C. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |