Cat. No.: IBDP-530834
Size:
Online InquiryTarget Information
| Sequence | AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEI CLDPEAPFLKKVIQKILDGGNKEN |
| Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
| Amino Acids | 41 to 114 |
| Cellular Localization | Secreted. |
| Function | Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Endotoxin Level | <0.05 Eu/µg |
| Protein Length | Protein fragment |
| Molecular Weight | 8 kDa |
| Active | Yes |
| Animal free | No |
| Nature | Recombinant |
| Application | FuncS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |