Cat. No.: IBDP-530834
Size:
Online InquiryTarget Information
Sequence | AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEI CLDPEAPFLKKVIQKILDGGNKEN |
Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
Amino Acids | 41 to 114 |
Cellular Localization | Secreted. |
Function | Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. |
Product Details
Product Type | Protein |
Species | Human |
Source | E. coli |
Endotoxin Level | <0.05 Eu/µg |
Protein Length | Protein fragment |
Molecular Weight | 8 kDa |
Active | Yes |
Animal free | No |
Nature | Recombinant |
Application | FuncS, SDS-PAGE |
Storage & Handling
Shipping | Shipped at 4 °C. |
Storage | Store at -20 °C. |
Handling | Avoid freeze / thaw cycle. |