Cat. No.: IBDP-530093
Size:
Online InquiryTarget Information
| Sequence | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKG QRCLNPKSKQARLIIKKVERKNF |
| Sequence Similarities | Belongs to the intercrine alpha (chemokine CxC) family. |
| Amino Acids | 22 to 94 |
| Cellular Localization | Secreted. |
| Tissue Specificity | High levels in peripheral blood leukocytes, pancreas and liver astrocytes. Moderate levels in thymus, spleen and lung. Low levels in placenta, prostate and small intestine. Also found in epidermal basal layer keratinocytes in skin disorders. |
| Function | Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Endotoxin Level | ≤0.005 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 8 kDa |
| Purity | ≥95% |
| Active | Yes |
| Animal free | Yes |
| Nature | Recombinant |
| Application | HPLC, MS, SDS-PAGE |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at Room Temperature. |
| Handling | Avoid freeze / thaw cycle. |