Recombinant Human CLECSF6 Protein

Target Information

Sequence	MTSEITYAEVRFKNEFKSSGINTASSAASKERTAPHKSNTGFPKLLCASL LIFFLLLAISFFIAFVIFFQKYSQLLEKKTTKELVHTTLECVKKNMPVEE TAWSCCPKNWKSFSSNCYFISTESASWQDSEKDCARMEAHLLVINTQEEQ DFIFQNLQEESAYFVGLSDPEGQRHWQWVDQTPYNESSTFWHPREPSDPN ERCVVLNFRKSPKRWGWNDVNCLGPQRSVCEMMKIHL
Sequence Similarities	Contains 1 C-type lectin domain.
Amino Acids	1 to 237
Cellular Localization	Membrane.
Tissue Specificity	Expressed in dendritic cells, myeloid cells, B-cells and HL-60 cells (at protein level). TNF alpha, IL-1 alpha, and LPS, down-regulated expression at the surface of neutrophils (at protein level). Expressed preferentially in hematopoietic tissues. Expressed in peripheral blood leukocytes, neutrophils, moderate quantities in spleen, lymph node, and bone marrow, and at very low levels in thymus. Expressed in Ag-presenting cells (DC, monocytes, macrophages and B-cells), as well as on granulocytes. Expression was decreased in DC by signals inducing its maturation (e.g. CD40 ligand, LPS, and TNF alpha).
Function	May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation. May be involved via its ITIM motif (immunoreceptor tyrosine-based inhibitory motifs) in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.

Product Details

Product Type	Protein
Species	Human
Source	Wheat Germ
Tag	GST
Protein Length	Full length protein
Animal free	No
Nature	Recombinant
Application	ELISA, WB

Storage & Handling

Shipping	Shipped with Dry Ice.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.