Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human CLECSF6 Protein

Cat. No.: IBDP-531617

Size:

Target Information

Sequence MTSEITYAEVRFKNEFKSSGINTASSAASKERTAPHKSNTGFPKLLCASL LIFFLLLAISFFIAFVIFFQKYSQLLEKKTTKELVHTTLECVKKNMPVEE TAWSCCPKNWKSFSSNCYFISTESASWQDSEKDCARMEAHLLVINTQEEQ DFIFQNLQEESAYFVGLSDPEGQRHWQWVDQTPYNESSTFWHPREPSDPN ERCVVLNFRKSPKRWGWNDVNCLGPQRSVCEMMKIHL
Sequence Similarities Contains 1 C-type lectin domain.
Amino Acids 1 to 237
Cellular Localization Membrane.
Tissue Specificity Expressed in dendritic cells, myeloid cells, B-cells and HL-60 cells (at protein level). TNF alpha, IL-1 alpha, and LPS, down-regulated expression at the surface of neutrophils (at protein level). Expressed preferentially in hematopoietic tissues. Expressed in peripheral blood leukocytes, neutrophils, moderate quantities in spleen, lymph node, and bone marrow, and at very low levels in thymus. Expressed in Ag-presenting cells (DC, monocytes, macrophages and B-cells), as well as on granulocytes. Expression was decreased in DC by signals inducing its maturation (e.g. CD40 ligand, LPS, and TNF alpha).
Function May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation. May be involved via its ITIM motif (immunoreceptor tyrosine-based inhibitory motifs) in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.

Product Details

Product Type Protein
Species Human
Source Wheat Germ
Tag GST
Protein Length Full length protein
Animal free No
Nature Recombinant
Application ELISA, WB

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.