Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human CEACAM8/CD66b Protein

Cat. No.: IBDP-530764

Size:

Target Information

Synonyms Carcinoembryonic antigen CGM6|||Carcinoembryonic antigen gene family member 6|||Carcinoembryonic antigen related cell adhesion molecule 8|||Carcinoembryonic antigen-related cell adhesion molecule 8|||CD 66b|||CD 67|||CD66b|||CD66b antigen|||CD67|||CD67 antigen|||CEACAM 8|||CEACAM8|||CEAM8_HUMAN|||CGM 6|||CGM6|||NCA 95|||NCA95|||Non-specific cross-reacting antigen NCA-95|||Nonspecific cross reacting antigen NCA 95|||Nonspecific cross reacting antigen NCA95
Sequence QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD

Product Details

Product Type Protein
Species Human
Source E. coli
Tag 6*His, SUMO
Endotoxin Level <1.0 Eu/µg
Molecular Weight 47.5 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.