Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human CEACAM7 Protein

Cat. No.: IBDP-532740

Size:

Target Information

Synonyms rHuCarcinoembryonic antigen-related cell adhesion molecule 7/CEACAM7, His|||Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7|||Carcinoembryonic Antigen CGM2|||CEACAM7|||CGM2
Sequence TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVF

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 20-30 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.