Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human CEACAM6 Protein

Cat. No.: IBDP-530811

Size:

Target Information

Synonyms Carcinoembryonic antigen related cell adhesion molecule 6 |||Carcinoembryonic antigen related cell adhesion molecule 6 non specific cross reacting antigen||||||Carcinoembryonic antigen-related cell adhesion molecule 6|||CD 66c|||CD66c|||CD66c antigen|||CEA LIKE PROTEIN|||CEACAM 6|||CEACAM6|||CEAL|||CEAM6_HUMAN|||MGC93832|||NCA|||Non specific cross reacting antigen|||Non-specific crossreacting antigen|||Normal cross reacting antigen|||Normal cross-reacting antigen
Sequence KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG

Product Details

Product Type Protein
Species Human
Source E. coli
Tag 6*His, SUMO
Endotoxin Level <1.0 Eu/µg
Molecular Weight 47.2 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.