Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human CEACAM3 Protein

Cat. No.: IBDP-530805

Size:

Target Information

Sequence KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVI GTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEA TGQFHVYQENAPGLPVGAVAGVDHHHHHH
Sequence Similarities Belongs to the immunoglobulin superfamily. CEA family. Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Amino Acids 35 to 155
Cellular Localization Membrane.
Tissue Specificity CGM1a, the predominant CGM1 transcript, is granulocyte-specific. Not detected out of the granulocytic lineage, such as monocytes, lymphocytes, spleen, testis, colon, brain, liver, pancreas, thymus, ovary, placenta, skeletal muscle, prostate, small intestine, heart, lung and kidney.
Function Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis.

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag His
Endotoxin Level <1.0 Eu/µg
Protein Length Protein fragment
Molecular Weight 14 kDa
Purity >95%
Active No
Animal free No
Nature Recombinant
Application HPLC, SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.