Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human CEACAM3 Protein

Cat. No.: IBDP-530807

Size:

Target Information

Synonyms carcinoembryonic |||Carcinoembryonic antigen CGM1|||Carcinoembryonic antigen gene family member 1|||carcinoembryonic antigen related cell adhesion molecule 3|||Carcinoembryonic antigen-related cell adhesion molecule 3|||cd66 d|||CD66d|||CD66d antigen|||CEA|||CEACAM 3|||CEACAM-3|||Ceacam3|||CEAM 3|||CEAM-3|||CEAM3|||CEAM3_HUMAN|||CGM1|||Nonspecific cross reacting antigen|||W264|||W282
Sequence KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG

Product Details

Product Type Protein
Species Human
Source E. coli
Tag 6*His, SUMO
Endotoxin Level <1.0 Eu/µg
Molecular Weight 29.1 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.