Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human CD84/SLAMF5 Protein

Cat. No.: IBDP-531526

Size:

Target Information

Synonyms SLAM family member 5|||Cell surface antigen MAX.3|||Hly9-beta|||Signaling lymphocytic activation molecule 5|||CD84
Sequence KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFR

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag Avi, 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 40-50 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.