Cat. No.: IBDP-530950
Size:
Online InquiryTarget Information
| Synonyms | 26 kDa cell surface protein TAPA 1|||26 kDa cell surface protein TAPA-1|||26 kDa cell surface protein TAPA1|||CD 81|||CD81|||CD81 antigen target of antiproliferative 1||||||CD81 antigen|||CD81 molecule|||CD81_HUMAN|||CVID6|||S5.7|||TAPA 1|||TAPA1|||Target of the antiproliferative 1|||Tetraspanin 28|||Tetraspanin-28|||Tetraspanin28|||Tspan 28|||Tspan-28|||Tspan28 |
| Sequence | FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Tag | 6*His, SUMO |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 25.8 kDa |
| Purity | ≥90% |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |