Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human CD32B Protein

Cat. No.: IBDP-530760

Size:

Target Information

Sequence TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIP THTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEF QEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSG DYHCTGNIGYTLYSSKPVTITVQAPVDHHHHHH
Sequence Similarities Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
Amino Acids 43 to 217
Cellular Localization Cell membrane.
Tissue Specificity Is the most broadly distributed Fc-gamma-receptor. Expressed in monocyte, neutrophils, macrophages, basophils, eosinophils, Langerhans cells, B-cells, platelets cells and placenta (endothelial cells). Not detected in natural killer cells.
Function Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells (TCR) or via another Fc receptor. Isoform IIB1 fails to mediate endocytosis or phagocytosis. Isoform IIB2 does not trigger phagocytosis.

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag His
Endotoxin Level <1.0 Eu/µg
Protein Length Protein fragment
Molecular Weight 21 kDa
Purity >95%
Active No
Animal free No
Nature Recombinant
Application HPLC, SDS-PAGE

Storage & Handling

Shipping Shipped at 4 °C.
Storage Store at -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.