Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human CD158d/KIR2DL4 Protein

Cat. No.: IBDP-532707

Size:

Target Information

Synonyms rHuCD158d, His|||Killer Cell Immunoglobulin-Like Receptor 2DL4|||CD158 Antigen-Like Family Member D|||KIR-103AS|||MHC Class I NK Cell Receptor KIR103AS|||CD158d|||KIR2DL4|||KIR103AS
Sequence WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHHHHHHH
Function CD158d/KIR2DL4 Protein (HEK293, His) is a recombinant human CD158d expressed in HEK 293 cells with a His tag at the N-terminus. CD158d/KIR2DL4 Protein is an NK cell-activating receptor with inhibitory potential.

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 38.87 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.