Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human CD14 Protein

Cat. No.: IBDP-530368

Size:

Target Information

Synonyms rHuCD14, His|||Monocyte Differentiation Antigen CD14|||Myeloid Cell-Specific Leucine-Rich Glycoprotein|||CD14
Sequence TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPAC
Function CD14 Protein (HEK293, His) is a recombinant human CD14 expressed in HEK 293 cells with a His tag at the N-terminus. CD14 Protein is an efficient target for recombinant immunoglobulin vaccine constructs that deliver T cell epitopes.

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 54 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.