Cat. No.: IBDP-530830
Size:
Online InquiryTarget Information
| Sequence | MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA |
| Sequence Similarities | Belongs to the G-protein coupled receptor 1 family. |
| Amino Acids | 1 to 42 |
| Cellular Localization | Cell membrane. |
| Function | Receptor for the MCP-1, MCP-3 and MCP-4 chemokines. Transduces a signal by increasing the intracellular calcium ions level. Alternative coreceptor with CD4 for HIV-1 infection. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | Wheat Germ |
| Tag | GST |
| Protein Length | Protein fragment |
| Molecular Weight | 30 kDa |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | ELISA, SDS-PAGE, WB |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |