Cat. No.: IBDP-531550
Size:
Online InquiryTarget Information
Sequence | FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQR SICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG |
Sequence Similarities | Belongs to the intercrine beta (chemokine CC) family. |
Amino Acids | 25 to 112 |
Cellular Localization | Secreted. |
Tissue Specificity | Testis, thymus, placenta, ovary and skin. |
Function | Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. Binds to CCR10. |
Product Details
Product Type | Protein |
Species | Human |
Source | HEK 293 Cells |
Endotoxin Level | ≤0.005 Eu/µg |
Protein Length | Full length protein |
Molecular Weight | 10 kDa |
Purity | ≥95% |
Active | Yes |
Animal free | Yes |
Nature | Recombinant |
Application | HPLC, MS, SDS-PAGE |
Storage & Handling
Shipping | Shipped at Room Temperature. |
Storage | Store at Room Temperature. |
Handling | Avoid freeze / thaw cycle. |