Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human CCL27 Protein

Cat. No.: IBDP-531551

Size:

Target Information

Synonyms rHuCCL27|||C-C Motif Chemokine 27|||CC Chemokine ILC|||Cutaneous T-Cell-Attracting Chemokine|||CTACK|||Eskine|||IL-11 R-Alpha-Locus Chemokine|||Skinkine|||Small-Inducible Cytokine A27|||CCL27|||ILC|||SCYA27
Sequence FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Function CCL27 Protein is a CC chemokine that binds to the chemokine receptor CCR10, attracts skin-associated memory T lymphocytes, mediates lymphocyte homing to skin sites, and plays a key role in skin inflammation. CCL27 Protein a recombinant human CCL27(F25-G112) protein expressed by E. coli.

Product Details

Product Type Protein
Species Human
Source E. coli
Tag Tag Free
Endotoxin Level <1.0 Eu/µg
Molecular Weight 14 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.