Cat. No.: IBDP-531551
Size:
Online InquiryTarget Information
| Synonyms | rHuCCL27|||C-C Motif Chemokine 27|||CC Chemokine ILC|||Cutaneous T-Cell-Attracting Chemokine|||CTACK|||Eskine|||IL-11 R-Alpha-Locus Chemokine|||Skinkine|||Small-Inducible Cytokine A27|||CCL27|||ILC|||SCYA27 |
| Sequence | FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG |
| Function | CCL27 Protein is a CC chemokine that binds to the chemokine receptor CCR10, attracts skin-associated memory T lymphocytes, mediates lymphocyte homing to skin sites, and plays a key role in skin inflammation. CCL27 Protein a recombinant human CCL27(F25-G112) protein expressed by E. coli. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Tag | Tag Free |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 14 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |