Cat. No.: IBDP-530077
Size:
Online InquiryTarget Information
| Synonyms | rHuCCL24, His|||C-C motif chemokine 24 |||CCL24|||Eosinophil chemotactic protein|||Eotaxin-2|||Myeloid progenitor inhibitory factor 2|||Small-inducible cytokine A24|||Ckb-6|||MPIF-2|||SCYA24 |
| Sequence | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTCHHHHHH |
| Function | CCL24/Eotaxin-2 Protein (HEK293, His) is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein (HEK293, His) is a recombinant human CCL24/Eotaxin-2 (V27-C119) protein expressed by HEK293 with a his tag. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Tag | 6*His |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 18 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |