Cat. No.: IBDP-530083
Size:
Online InquiryTarget Information
| Sequence | SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAE LCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCK RTERSQTPKGP |
| Sequence Similarities | Belongs to the intercrine beta (chemokine CC) family. |
| Amino Acids | 24 to 134 |
| Cellular Localization | Secreted. |
| Tissue Specificity | Highly expressed in high endothelial venules of lymph nodes, spleen and appendix. Intermediate levels found in small intestine, thyroid gland and trachea. Low level expression in thymus, bone marrow, liver, and pancreas. Also found in tonsil, fetal heart and fetal spleen. |
| Function | Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Endotoxin Level | ≤1.0 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 12 kDa |
| Purity | >95% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | SDS-PAGE |
Storage & Handling
| Shipping | Shipped at 4 °C. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |