Cat. No.: IBDP-530941
Size:
Online InquiryTarget Information
Sequence | AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQIC ADPNKKWVQKYISDLKLNA |
Sequence Similarities | Belongs to the intercrine beta (chemokine CC) family. |
Amino Acids | 21 to 89 |
Cellular Localization | Secreted. |
Tissue Specificity | Expressed at high levels in lung, lymph nodes, placenta, bone marrow, dendritic cells present in germinal centers and T-cell areas of secondary lymphoid organs and macrophages derived from peripheral blood monocytes. Not expressed by peripheral blood monocytes and a monocyte-to-macrophage differentiation is a prerequisite for expression. Expressed in synovial fluids from patients with rheumatoid and septic arthritis and in ovarian carcinoma ascitic fluid. |
Function | Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses. |
Product Details
Product Type | Protein |
Species | Human |
Source | E. coli |
Endotoxin Level | ≤1.0 Eu/µg |
Protein Length | Full length protein |
Molecular Weight | 8 kDa |
Purity | >95% |
Active | No |
Animal free | No |
Nature | Recombinant |
Application | FuncS, SDS-PAGE |
Storage & Handling
Shipping | Shipped at Room Temperature. |
Storage | Store at -20 °C. |
Handling | Avoid freeze / thaw cycle. |