Cat. No.: IBDP-530673
Size:
Online InquiryTarget Information
| Synonyms | C-C Motif Chemokine 1|||Small-Inducible Cytokine A1|||T Lymphocyte-Secreted Protein I-309|||CCL1|||SCYA1 |
| Sequence | KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
| Function | CCL1 Protein is a cytokine that mediates inflammatory immune responses, viral infections, and tumorigenesis by interacting with the CCR8 chemokine receptor on the cell surface and attracting monocytes, natural killer cells, and immature B-cell nuclear dendritic cells. CCL1 Protein is a recombinant human CCL1 (K24-K96) expressed by E. coli. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Tag | Tag Free |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 11.0 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |