Recombinant Human Cathepsin F Protein

Target Information

Sequence	PEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQE LLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNFSAEK AKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRP LCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGAC GVNTMASSAVVD
Sequence Similarities	Belongs to the peptidase C1 family.
Amino Acids	273 to 484
Cellular Localization	Lysosome.
Tissue Specificity	High expression levels in heart, skeletal muscle, brain, testis and ovary; moderate levels in prostate, placenta, liver and colon; and no detectable expression in peripheral leukocytes and thymus.
Function	Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.

Product Details

Product Type	Protein
Species	Human
Source	E. coli
Tag	His
Protein Length	Protein fragment
Molecular Weight	27 kDa
Purity	>90%
Active	No
Animal free	No
Nature	Recombinant
Application	MS, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C or -80 °C.
Handling	Avoid freeze / thaw cycle.