Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human CADM3 Protein

Cat. No.: IBDP-531299

Size:

Target Information

Synonyms rHuCell adhesion molecule 3/CADM3, His|||Cell Adhesion Molecule 3|||Brain Immunoglobulin Receptor|||Immunoglobulin Superfamily Member 4B|||IgSF4B|||Nectin-Like Protein 1|||NECL-1|||Synaptic Cell Adhesion Molecule 3|||SynCAM3|||TSLC1-Like Protein 1|||TSLL1|||CADM3|||IGSF4B|||NECL1|||SYNCAM3|||TSLL1
Sequence NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYH

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 35-42 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.