Cat. No.: IBDP-530999
Size:
Online InquiryTarget Information
| Sequence | GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK |
| Sequence Similarities | Belongs to the beta-defensin family. |
| Amino Acids | 23 to 67 |
| Cellular Localization | Secreted. |
| Tissue Specificity | Highly expressed in skin and tonsils, and to a lesser extent in trachea, uterus, kidney, thymus, adenoid, pharynx and tongue. Low expression in salivary gland, bone marrow, colon, stomach, polyp and larynx. No expression in small intestine. |
| Function | Exhibits antimicrobial activity against Gram-positive bacteria S.aureus and S.pyogenes, Gram-negative bacteria P.aeruginosa and E.coli and the yeast C.albicans. Kills multiresistant S.aureus and vancomycin-resistent E.faecium. No significant hemolytic activity was observed. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Endotoxin Level | ≤1.0 Eu/µg |
| Protein Length | Full length protein |
| Molecular Weight | 5 kDa |
| Purity | ≥95% |
| Active | No |
| Animal free | No |
| Nature | Recombinant |
| Application | SDS-PAGE |
Storage & Handling
| Shipping | Shipped at room temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |