Cat. No.: IBDP-530425
Size:
Online InquiryTarget Information
| Synonyms | rHuApoptosis Regulator Bcl-2, His|||B-cell Lymphoma 2|||Apoptosis Regulator Bcl-2 |
| Sequence | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD |
| Function | BCL2 Protein (His) expresses in E. coli with a His tag at the N-terminus. Proteins of the Bcl-2 family are important regulators of apoptosis in many tissues of the embryo and adult. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | E. coli |
| Tag | 6*His |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 22-27 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |