Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human B7-H4 Protein

Cat. No.: IBDP-531254

Size:

Target Information

Synonyms B7S1|||B7x|||Vtcn1|||B7h.5|||B7S1VCTN1|||B7XPRO1291|||FLJ22418|||Protein B7S1|||T cell costimulatory molecule B7x|||V-set domain containing T cell activation inhibitor 1
Sequence FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSK

Product Details

Product Type Protein
Species Human
Source HEK 293 Cells
Tag Avi, hFc
Endotoxin Level <1.0 Eu/µg
Molecular Weight 70-95 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.