Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Human Animal-Free IL-12 beta Protein

Cat. No.: IBDP-530736

Size:

Target Information

Synonyms Interleukin-12 subunit beta|||IL-12B|||Cytotoxic lymphocyte maturation factor 40 kDa subunit|||CLMF p40|||IL-12 subunit p40|||NK cell stimulatory factor chain 2|||NKSF2|||IL12B|||NKSF2
Sequence MIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Product Details

Product Type Protein
Species Human
Source E. coli
Tag His
Endotoxin Level <0.1 Eu/μg
Molecular Weight 35.64 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.