Cat. No.: IBDP-531054
Size:
Online InquiryTarget Information
| Synonyms | CD137|||ILA|||TNFRSF9|||4-1BB ligand receptor|||CDw137|||T-cell antigen 4-1BB homolog|||T-cell antigen ILA |
| Sequence | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
| Function | 4-1BB (CD137; TNFRSF9), a receptor of TNFSF9/4-1BBL, belongs to the tumor necrosis factor (TNF) receptor superfamily. 4-1BB is helpful for T cell activation and development, and also induces peripheral mononuclear cell proliferation and migration to the tumor microenvironment. 4-1BB is also involved in enhancing Nrf2 and NF-κB pathway mediated apoptosis of endothelial cells. Human 4-1BB protein is a surface glycoprotein with a transmembrane domain (187-213 a.a.). 4-1BB/TNFRSF9 Protein (163a.a, HEK293, His) is the extracellular part (L24-Q186) of 4-1BB protein, produced by HEK293 cells with C-terminal 6*His-tag. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Tag | 6*His |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 28-35 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |