Cat. No.: IBDP-531053
Size:
Online InquiryTarget Information
| Synonyms | CD137|||ILA|||TNFRSF9|||4-1BB ligand receptor|||CDw137|||T-cell antigen 4-1BB homolog|||T-cell antigen ILA |
| Sequence | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
| Function | 4-1BB/TNFRSF9 Protein (HEK 293, Fc), a recombinant human 4-1BB/TNFRSF9 Protein produced in HEK293 cells, has an Fc fragment at the C-terminus. Recombinant Human 4-1BBRTNFRSF9, an inducible T cell molecule belonging to the TNF receptor superfamily, could promote the expansion of antigen-specific T cells and prevent activation-induced death of CD8+ T cells. |
Product Details
| Product Type | Protein |
| Species | Human |
| Source | HEK 293 Cells |
| Tag | hFc |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 58.0 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped with Dry Ice. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |