Recombinant Dog IL-8 Protein

Target Information

Sequence	AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFN GNEVCLDPKEKWVQKVVQIFLKKAEKQDP
Sequence Similarities	Belongs to the intercrine alpha (chemokine CxC) family.
Amino Acids	23 to 101
Cellular Localization	Secreted.
Function	IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.

Product Details

Product Type	Protein
Species	Dog
Source	E. coli
Protein Length	Full length protein
Molecular Weight	9 kDa
Purity	>95%
Active	Yes
Animal free	No
Nature	Recombinant
Application	FuncS, HPLC, SDS-PAGE

Storage & Handling

Shipping	Shipped at 4 °C.
Storage	Store at -20 °C.
Handling	Avoid freeze / thaw cycle.